GLP-2T

GLP-2T

Description

GLP-2T is a double-receptor agonist compound targeting GLP-1 and GIP receptors that is developed exclusively for research purposes. Researchers study it for its effects on metabolic pathways. GLP-2T (scientific designation LY3298176) is a novel, long-acting dual agonist of the GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulinotropic polypeptide) receptors. This unique combination makes GLP-2T an important research tool for studying glucose regulation, weight management, and metabolic disease models.

Researchers use GLP-2T to investigate insulin secretion, appetite regulation, gastric emptying, and fat metabolism in preclinical and clinical studies. Its dual-incretin activity allows exploration of synergistic effects on glycemic control and energy balance.

Key Research Applications:
• Intestinal-related signaling pathway analysis
• Receptor interaction and binding studies
• Cellular response evaluation in controlled in vitro models
• Peptide stability and degradation research
• Molecular characterization and assay development

Product Specifications

• Quantity: 10 mg · 20 mg · 30 mg · 40 mg · 60 mg

• Form: Crystalline lyophilized peptide

• Sequence: HSDGTFTSDVSSYLEGQAAKEFIAWLVKGRG

• Molecular Formula: C₁₆₈H₂₆₆N₄₈O₅₃

• Molecular Weight: 3,829.2 g/mol

• Purity: ≥98% (HPLC)

• Solubility: Soluble in sterile water or compatible aqueous buffers

• Characterization: HPLC, Mass Spectrometry

• CAS Number: 2023788-19-2

• Storage: −20 °C or below

• Shelf Life: Up to 24 months (lyophilized)

• Intended Use: For laboratory research use only. Not for human or veterinary use.

Disclaimer, Intended Use & Terms of Sale

All content and information provided are for educational and research reference purposes only. This product and its associated data have not been evaluated by the U.S. Food and Drug Administration, and no claims are made regarding the diagnosis, treatment, cure, or prevention of any disease. No representations or warranties are made regarding safety, effectiveness, or outcomes.

This product is intended strictly for in vitro laboratory research use only and is not for clinical use. It is not approved for human or animal administration and must not be used in food, dietary supplements, pharmaceuticals, cosmetics, or any consumer applications. Use is restricted to qualified professionals operating in certified laboratory settings.

By purchasing from Badger Compounds, the buyer affirms that they are a qualified researcher or institution with the appropriate training, facilities, and authorization to handle, store, use, and dispose of research chemicals in compliance with all applicable federal, state, and local laws and regulations. All sales are final. Badger Compounds assumes no liability for misuse, improper handling, or any consequences arising from the use of this product.